PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010088452.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NF-YB
Protein Properties Length: 208aa    MW: 21578.9 Da    PI: 6.5209
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010088452.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1832.4e-5726121297
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                     reqdr+lPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplk+yl+++re+ege
  XP_010088452.1  26 REQDRLLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKIYLQRFRETEGE 120
                     89********************************************************************************************9 PP

           NF-YB  97 k 97 
                     k
  XP_010088452.1 121 K 121
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.0E-5520128IPR009072Histone-fold
SuperFamilySSF471134.19E-4028124IPR009072Histone-fold
PfamPF008081.3E-273195IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-205977No hitNo description
PROSITE patternPS0068506278IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-207896No hitNo description
PRINTSPR006151.5E-2097115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MADSDNDSGG GGNNNRGDAN SEMSLREQDR LLPIANVSRI MKKALPANAK ISKDAKETVQ  60
ECVSEFISFI TGEASDKCQR EKRKTINGDD LLWAMTTLGF EDYVEPLKIY LQRFRETEGE  120
KGGATTVARE KDVAAGSVGN GGAGGVGFGD GGAGGGGVYG MVMMGQQHQG HVYGSGGFHQ  180
LGVGSGGSGL AKNGPGHISP GSNLGRPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B2e-4923116194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4923116194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892183e-85AC189218.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB010F13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088452.11e-151Nuclear transcription factor Y subunit B-3
SwissprotO233103e-71NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLW9QFK91e-151W9QFK9_9R
STRINGVIT_19s0015g00440.t012e-88(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.17e-67nuclear factor Y, subunit B3